PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G060500.1
Common NamePHAVU_007G060500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CPP
Protein Properties Length: 772aa    MW: 84457.6 Da    PI: 6.4631
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G060500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25.2e-16482520240
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Phvul.007G060500.1 482 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCRDCFNKP 520
                         689**********************************96 PP

2TCR50.15.5e-16567606140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN+ 
  Phvul.007G060500.1 567 RHKRGCNCKKSSCLKKYCECYQGGVGCSISCRCEGCKNTY 606
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.2E-19481522IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.747482607IPR005172CRC domain
PfamPF036381.6E-11484519IPR005172CRC domain
SMARTSM011142.6E-17567608IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-11569605IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MDTPDRSKIN TPLSQFEDSP VFNYISNLSP IEPVKSVHIT QTFNSLSFSS PPSVFTSPHV  60
NCHRESRFLR RHNLLDASKP KGSSEDINNV YLCEKTPADS SQPCHESSEP QENTNPNISI  120
RDASNELCNE NPNISVEVPQ GLKYNLASPG YDPVISADEA DSLLELPGKP GSDVAYVPDD  180
SEKNSIEGEM HPPGLCQNEE KIEGPDCGVD DLITEASDLL MFSPPNLTEA FKDINKQLNP  240
STKLTNFRTL LQQSATNDGQ QMHIVDAVAS GSEHEIENHP CEPGAATDTV QRQDNHSNVA  300
LVASNPTEKM DDKLLYVTHR GIRRRCLDFE MASVQRKNLD GKSHTNSSTE KSDEMDVSKG  360
KQVLPIKHSG DSRKCVLPGI GLHLNALATL NDCKNIKIEK LLAGRQPNMP SSSSSVQLSA  420
SQEHQLALVP ASVEKDLEPS ENEVQPGEDC TQPLLLMAGE DFQQNSPKRK RRRLEPDGEG  480
ESCKRCNCKK SKCLKLYCEC FAAGVYCIEP CSCRDCFNKP IHVDTVLQTR QQIESRNPLA  540
FAPKVIRSSD SVPEIGDDPN KTPASARHKR GCNCKKSSCL KKYCECYQGG VGCSISCRCE  600
GCKNTYGRKD GSVPSGIEAK PEEETEACEK GVMENASHKT ETQNIENHPD HALPTTPLRI  660
SRSLLPLPFS SKGKPPRSFV TTISSSGLFV SQKLGKSSAP RSQPKFDKPL QTVPDDDSPV  720
TCIKTSSPNG KRISSPNCDV GSSPTRRGGR KLILQSIPSF PSLTPHNLRS D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1466473PKRKRRRL
2467472KRKRRR
3468472RKRRR
4469473KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143298.10.0hypothetical protein PHAVU_007G060500g
TrEMBLV7BBQ70.0V7BBQ7_PHAVU; Uncharacterized protein
STRINGGLYMA20G28740.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-112TESMIN/TSO1-like CXC 2